PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010087663.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Trihelix
Protein Properties Length: 354aa    MW: 39806.1 Da    PI: 6.1365
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010087663.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix60.34.7e-19296354159
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnk 59 
                     +W++ ev+aLi++r+ +e++++ + +k+  Wee+s+ m++ g++r++k+C+e wen+nk
  XP_010087663.1 296 KWPEAEVQALIALRTVLEHKFQVSGSKGSIWEEISAGMHSMGYKRTAKKCREQWENINK 354
                     7********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.329289353IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.2E-5294352IPR009057Homeodomain-like
CDDcd122033.69E-24295354No hitNo description
PfamPF138373.6E-13296354No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEVFAGDRQI PNPDGFPQHI APFPEPTDLI YDHPTAVLHS PDIINHRPIS PPQKLRPIRC  60
NARYPAGEFP DSGGLVGTLG NGFLSSQTGC FDGEFEWAVK VEGGDAPPMS TVCGNVSAAA  120
DDPIGVGSGT SVEGWKPDGV KRGLENESRF FPVLSSSSDD GVECLATNFK GPVNQKRRRK  180
SRRNDLEHFL ESLVMEVMEK QEKMHKQLLE MMEKMEKERV MREEAWKQLE IERRKRDEMV  240
RAEETSRSLA LISFIQNLLG EEIKIPKPGP QLTVEENGVK TDSQPDNKRD TNNKIKWPEA  300
EVQALIALRT VLEHKFQVSG SKGSIWEEIS AGMHSMGYKR TAKKCREQWE NINK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00552DAPTransfer from AT5G47660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087663.10.0hypothetical protein L484_010615
TrEMBLW9QZA60.0W9QZA6_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF111123338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.15e-34Trihelix family protein